SNX11 purified MaxPab mouse polyclonal antibody (B02P)
  • SNX11 purified MaxPab mouse polyclonal antibody (B02P)

SNX11 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00029916-B02P
SNX11 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNX11 protein.
Información adicional
Size 50 ug
Gene Name SNX11
Gene Alias MGC111019
Gene Description sorting nexin 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNX11 (NP_037455.2, 1 a.a. ~ 270 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29916

Enviar uma mensagem


SNX11 purified MaxPab mouse polyclonal antibody (B02P)

SNX11 purified MaxPab mouse polyclonal antibody (B02P)