HCFC2 purified MaxPab mouse polyclonal antibody (B01P)
  • HCFC2 purified MaxPab mouse polyclonal antibody (B01P)

HCFC2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029915-B01P
HCFC2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HCFC2 protein.
Información adicional
Size 50 ug
Gene Name HCFC2
Gene Alias FLJ94012|HCF-2|HCF2
Gene Description host cell factor C2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPVTKGVVPSPRESHTAVIYCKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HCFC2 (NP_037452.1, 1 a.a. ~ 792 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29915

Enviar uma mensagem


HCFC2 purified MaxPab mouse polyclonal antibody (B01P)

HCFC2 purified MaxPab mouse polyclonal antibody (B01P)