HOOK2 polyclonal antibody (A01)
  • HOOK2 polyclonal antibody (A01)

HOOK2 polyclonal antibody (A01)

Ref: AB-H00029911-A01
HOOK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HOOK2.
Información adicional
Size 50 uL
Gene Name HOOK2
Gene Alias FLJ26218|HK2
Gene Description hook homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LEESVQHVVMEAIQELMTKDTPDSLSPETYGNFDSQSRRYYFLSEEAEEGDELQQRCLDLERQLMLLSEEKQSLAQENAGLRERMGRPEGEGTPGLTAKK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HOOK2 (NP_037444, 138 a.a. ~ 237 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29911

Enviar uma mensagem


HOOK2 polyclonal antibody (A01)

HOOK2 polyclonal antibody (A01)