SNX15 monoclonal antibody (M01), clone 1D4
  • SNX15 monoclonal antibody (M01), clone 1D4

SNX15 monoclonal antibody (M01), clone 1D4

Ref: AB-H00029907-M01
SNX15 monoclonal antibody (M01), clone 1D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNX15.
Información adicional
Size 100 ug
Gene Name SNX15
Gene Alias HSAF001435
Gene Description sorting nexin 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq RYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNX15 (NP_037438, 51 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29907
Clone Number 1D4
Iso type IgG3 Kappa

Enviar uma mensagem


SNX15 monoclonal antibody (M01), clone 1D4

SNX15 monoclonal antibody (M01), clone 1D4