MYLPF monoclonal antibody (M05), clone 3H3
  • MYLPF monoclonal antibody (M05), clone 3H3

MYLPF monoclonal antibody (M05), clone 3H3

Ref: AB-H00029895-M05
MYLPF monoclonal antibody (M05), clone 3H3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant MYLPF.
Información adicional
Size 100 ug
Gene Name MYLPF
Gene Alias DKFZp779C0757|MGC13450|MRLC2
Gene Description fast skeletal myosin light chain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,S-ELISA,ELISA
Immunogen Prot. Seq MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MYLPF (AAH12571, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29895
Clone Number 3H3
Iso type IgG2a Kappa

Enviar uma mensagem


MYLPF monoclonal antibody (M05), clone 3H3

MYLPF monoclonal antibody (M05), clone 3H3