CNOT7 monoclonal antibody (M01A), clone 2F6
  • CNOT7 monoclonal antibody (M01A), clone 2F6

CNOT7 monoclonal antibody (M01A), clone 2F6

Ref: AB-H00029883-M01A
CNOT7 monoclonal antibody (M01A), clone 2F6

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CNOT7.
Información adicional
Size 200 uL
Gene Name CNOT7
Gene Alias CAF1|hCAF-1
Gene Description CCR4-NOT transcription complex, subunit 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNOT7 (AAH60852, 1 a.a. ~ 285 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 29883
Clone Number 2F6
Iso type IgG2a Kappa

Enviar uma mensagem


CNOT7 monoclonal antibody (M01A), clone 2F6

CNOT7 monoclonal antibody (M01A), clone 2F6