CNOT7 polyclonal antibody (A01)
  • CNOT7 polyclonal antibody (A01)

CNOT7 polyclonal antibody (A01)

Ref: AB-H00029883-A01
CNOT7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CNOT7.
Información adicional
Size 50 uL
Gene Name CNOT7
Gene Alias CAF1|hCAF-1
Gene Description CCR4-NOT transcription complex, subunit 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNOT7 (NP_037486, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29883

Enviar uma mensagem


CNOT7 polyclonal antibody (A01)

CNOT7 polyclonal antibody (A01)