ICOS monoclonal antibody (M02), clone 3G4
  • ICOS monoclonal antibody (M02), clone 3G4

ICOS monoclonal antibody (M02), clone 3G4

Ref: AB-H00029851-M02
ICOS monoclonal antibody (M02), clone 3G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ICOS.
Información adicional
Size 100 ug
Gene Name ICOS
Gene Alias AILIM|CD278|MGC39850
Gene Description inducible T-cell co-stimulator
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ICOS (NP_036224.1, 21 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29851
Clone Number 3G4
Iso type IgG2a Kappa

Enviar uma mensagem


ICOS monoclonal antibody (M02), clone 3G4

ICOS monoclonal antibody (M02), clone 3G4