TFCP2L1 purified MaxPab mouse polyclonal antibody (B01P)
  • TFCP2L1 purified MaxPab mouse polyclonal antibody (B01P)

TFCP2L1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029842-B01P
TFCP2L1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TFCP2L1 protein.
Información adicional
Size 50 ug
Gene Name TFCP2L1
Gene Alias CRTR1|LBP-9|LBP9
Gene Description transcription factor CP2-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYLNQGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEHQQLEGWRWSRPGDRILDIDIPLSVGILDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TFCP2L1 (NP_055368.1, 1 a.a. ~ 479 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29842

Enviar uma mensagem


TFCP2L1 purified MaxPab mouse polyclonal antibody (B01P)

TFCP2L1 purified MaxPab mouse polyclonal antibody (B01P)