Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
VPREB3 monoclonal antibody (M08), clone 4H8
Abnova
VPREB3 monoclonal antibody (M08), clone 4H8
Ref: AB-H00029802-M08
VPREB3 monoclonal antibody (M08), clone 4H8
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant VPREB3.
Información adicional
Size
100 ug
Gene Name
VPREB3
Gene Alias
8HS20|N27C7-2
Gene Description
pre-B lymphocyte 3
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq
QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
VPREB3 (NP_037510, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
29802
Clone Number
4H8
Iso type
IgG1 Kappa
Enviar uma mensagem
VPREB3 monoclonal antibody (M08), clone 4H8
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*