UCRC monoclonal antibody (M07), clone 2B5
  • UCRC monoclonal antibody (M07), clone 2B5

UCRC monoclonal antibody (M07), clone 2B5

Ref: AB-H00029796-M07
UCRC monoclonal antibody (M07), clone 2B5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant UCRC.
Información adicional
Size 100 ug
Gene Name UCRC
Gene Alias HSPC051|HSPC119|HSPC151
Gene Description ubiquinol-cytochrome c reductase complex (7.2 kD)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UCRC (AAH05402, 1 a.a. ~ 63 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29796
Clone Number 2B5
Iso type IgG2b Kappa

Enviar uma mensagem


UCRC monoclonal antibody (M07), clone 2B5

UCRC monoclonal antibody (M07), clone 2B5