BLNK purified MaxPab rabbit polyclonal antibody (D01P)
  • BLNK purified MaxPab rabbit polyclonal antibody (D01P)

BLNK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00029760-D01P
BLNK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human BLNK protein.
Información adicional
Size 100 ug
Gene Name BLNK
Gene Alias BASH|BLNK-S|LY57|MGC111051|SLP-65|SLP65
Gene Description B-cell linker
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BLNK (AAH18906.1, 1 a.a. ~ 456 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29760

Enviar uma mensagem


BLNK purified MaxPab rabbit polyclonal antibody (D01P)

BLNK purified MaxPab rabbit polyclonal antibody (D01P)