RACGAP1 monoclonal antibody (M01), clone 1G6
  • RACGAP1 monoclonal antibody (M01), clone 1G6

RACGAP1 monoclonal antibody (M01), clone 1G6

Ref: AB-H00029127-M01
RACGAP1 monoclonal antibody (M01), clone 1G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RACGAP1.
Información adicional
Size 100 ug
Gene Name RACGAP1
Gene Alias HsCYK-4|ID-GAP|MgcRacGAP
Gene Description Rac GTPase activating protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMKAETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RACGAP1 (AAH32754, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29127
Clone Number 1G6
Iso type IgG2b Kappa

Enviar uma mensagem


RACGAP1 monoclonal antibody (M01), clone 1G6

RACGAP1 monoclonal antibody (M01), clone 1G6