CD274 polyclonal antibody (A01)
  • CD274 polyclonal antibody (A01)

CD274 polyclonal antibody (A01)

Ref: AB-H00029126-A01
CD274 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CD274.
Información adicional
Size 50 uL
Gene Name CD274
Gene Alias B7-H|B7H1|MGC142294|MGC142296|PD-L1|PDCD1L1|PDCD1LG1|PDL1
Gene Description CD274 molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CD274 (NP_054862, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29126

Enviar uma mensagem


CD274 polyclonal antibody (A01)

CD274 polyclonal antibody (A01)