NXT1 monoclonal antibody (M08), clone 4F11
  • NXT1 monoclonal antibody (M08), clone 4F11

NXT1 monoclonal antibody (M08), clone 4F11

Ref: AB-H00029107-M08
NXT1 monoclonal antibody (M08), clone 4F11

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NXT1.
Información adicional
Size 100 ug
Gene Name NXT1
Gene Alias MTR2|P15
Gene Description NTF2-like export factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NXT1 (AAH00759, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29107
Clone Number 4F11
Iso type IgG1 Lambda

Enviar uma mensagem


NXT1 monoclonal antibody (M08), clone 4F11

NXT1 monoclonal antibody (M08), clone 4F11