NXT1 purified MaxPab mouse polyclonal antibody (B01P)
  • NXT1 purified MaxPab mouse polyclonal antibody (B01P)

NXT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029107-B01P
NXT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NXT1 protein.
Información adicional
Size 50 ug
Gene Name NXT1
Gene Alias MTR2|P15
Gene Description NTF2-like export factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NXT1 (AAH00759, 1 a.a. ~ 140 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29107

Enviar uma mensagem


NXT1 purified MaxPab mouse polyclonal antibody (B01P)

NXT1 purified MaxPab mouse polyclonal antibody (B01P)