HEMK2 purified MaxPab mouse polyclonal antibody (B01P)
  • HEMK2 purified MaxPab mouse polyclonal antibody (B01P)

HEMK2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029104-B01P
HEMK2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HEMK2 protein.
Información adicional
Size 50 ug
Gene Name N6AMT1
Gene Alias C21orf127|HEMK2|MGC19995|MTQ2|N6AMT|PRED28
Gene Description N-6 adenine-specific DNA methyltransferase 1 (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HEMK2 (AAH11554.1, 1 a.a. ~ 186 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29104

Enviar uma mensagem


HEMK2 purified MaxPab mouse polyclonal antibody (B01P)

HEMK2 purified MaxPab mouse polyclonal antibody (B01P)