MRPL22 purified MaxPab mouse polyclonal antibody (B01P)
  • MRPL22 purified MaxPab mouse polyclonal antibody (B01P)

MRPL22 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029093-B01P
MRPL22 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPL22 protein.
Información adicional
Size 50 ug
Gene Name MRPL22
Gene Alias DKFZp781F1071|HSPC158|L22mt|MRP-L22|MRP-L25|RPML25
Gene Description mitochondrial ribosomal protein L22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHTSASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKECIQQLRSRTIVHTL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPL22 (AAH12565, 1 a.a. ~ 206 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29093

Enviar uma mensagem


MRPL22 purified MaxPab mouse polyclonal antibody (B01P)

MRPL22 purified MaxPab mouse polyclonal antibody (B01P)