C18orf55 purified MaxPab mouse polyclonal antibody (B01P)
  • C18orf55 purified MaxPab mouse polyclonal antibody (B01P)

C18orf55 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00029090-B01P
C18orf55 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C18orf55 protein.
Información adicional
Size 50 ug
Gene Name C18orf55
Gene Alias HSPC154
Gene Description chromosome 18 open reading frame 55
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSKIYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYAQVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C18orf55 (AAH00892.1, 1 a.a. ~ 248 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29090

Enviar uma mensagem


C18orf55 purified MaxPab mouse polyclonal antibody (B01P)

C18orf55 purified MaxPab mouse polyclonal antibody (B01P)