UBE2T purified MaxPab rabbit polyclonal antibody (D01P)
  • UBE2T purified MaxPab rabbit polyclonal antibody (D01P)

UBE2T purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00029089-D01P
UBE2T purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UBE2T protein.
Información adicional
Size 100 ug
Gene Name UBE2T
Gene Alias HSPC150|PIG50
Gene Description ubiquitin-conjugating enzyme E2T (putative)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBE2T (NP_054895.1, 1 a.a. ~ 197 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29089

Enviar uma mensagem


UBE2T purified MaxPab rabbit polyclonal antibody (D01P)

UBE2T purified MaxPab rabbit polyclonal antibody (D01P)