KLF15 purified MaxPab rabbit polyclonal antibody (D01P)
  • KLF15 purified MaxPab rabbit polyclonal antibody (D01P)

KLF15 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00028999-D01P
KLF15 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KLF15 protein.
Información adicional
Size 100 ug
Gene Name KLF15
Gene Alias DKFZp779M1320|KKLF
Gene Description Kruppel-like factor 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLF15 (NP_054798.1, 1 a.a. ~ 416 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28999

Enviar uma mensagem


KLF15 purified MaxPab rabbit polyclonal antibody (D01P)

KLF15 purified MaxPab rabbit polyclonal antibody (D01P)