HIPK2 monoclonal antibody (M08), clone 1D8
  • HIPK2 monoclonal antibody (M08), clone 1D8

HIPK2 monoclonal antibody (M08), clone 1D8

Ref: AB-H00028996-M08
HIPK2 monoclonal antibody (M08), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant HIPK2.
Información adicional
Size 100 ug
Gene Name HIPK2
Gene Alias DKFZp686K02111|FLJ23711|PRO0593
Gene Description homeodomain interacting protein kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSSTSATISLANPEVSILNYPSTLYQPSAASMAAVAQRSMPLQTGTAQICARPDPFQQAL IVCPPGFQGLQASPSKHAGYS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIPK2 (NP_073577.2, 213 a.a. ~ 293 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28996
Clone Number 1D8
Iso type IgG2b Kappa

Enviar uma mensagem


HIPK2 monoclonal antibody (M08), clone 1D8

HIPK2 monoclonal antibody (M08), clone 1D8