HIPK2 monoclonal antibody (M06), clone 4E3
  • HIPK2 monoclonal antibody (M06), clone 4E3

HIPK2 monoclonal antibody (M06), clone 4E3

Ref: AB-H00028996-M06
HIPK2 monoclonal antibody (M06), clone 4E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant HIPK2.
Información adicional
Size 100 ug
Gene Name HIPK2
Gene Alias DKFZp686K02111|FLJ23711|PRO0593
Gene Description homeodomain interacting protein kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HIPK2 (AAG41236.1, 961 a.a. ~ 1065 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28996
Clone Number 4E3
Iso type IgG2a Kappa

Enviar uma mensagem


HIPK2 monoclonal antibody (M06), clone 4E3

HIPK2 monoclonal antibody (M06), clone 4E3