FLVCR monoclonal antibody (M05), clone 4B2
  • FLVCR monoclonal antibody (M05), clone 4B2

FLVCR monoclonal antibody (M05), clone 4B2

Ref: AB-H00028982-M05
FLVCR monoclonal antibody (M05), clone 4B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FLVCR.
Información adicional
Size 100 ug
Gene Name FLVCR1
Gene Alias FLVCR
Gene Description feline leukemia virus subgroup C cellular receptor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTPLAPEEETQARLLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FLVCR (NP_054772, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28982
Clone Number 4B2
Iso type IgG2b Kappa

Enviar uma mensagem


FLVCR monoclonal antibody (M05), clone 4B2

FLVCR monoclonal antibody (M05), clone 4B2