MRPS18B purified MaxPab mouse polyclonal antibody (B02P)
  • MRPS18B purified MaxPab mouse polyclonal antibody (B02P)

MRPS18B purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00028973-B02P
MRPS18B purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPS18B protein.
Información adicional
Size 50 ug
Gene Name MRPS18B
Gene Alias C6orf14|DKFZp564H0223|HSPC183|HumanS18a|MRP-S18-2|MRPS18-2|PTD017|S18amt
Gene Description mitochondrial ribosomal protein S18B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS18B (NP_054765.1, 1 a.a. ~ 258 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28973

Enviar uma mensagem


MRPS18B purified MaxPab mouse polyclonal antibody (B02P)

MRPS18B purified MaxPab mouse polyclonal antibody (B02P)