SLC6A16 monoclonal antibody (M13), clone 2E5
  • SLC6A16 monoclonal antibody (M13), clone 2E5

SLC6A16 monoclonal antibody (M13), clone 2E5

Ref: AB-H00028968-M13
SLC6A16 monoclonal antibody (M13), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC6A16.
Información adicional
Size 100 ug
Gene Name SLC6A16
Gene Alias NTT5
Gene Description solute carrier family 6, member 16
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC6A16 (NP_054756.2, 406 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28968
Clone Number 2E5
Iso type IgG1 Kappa

Enviar uma mensagem


SLC6A16 monoclonal antibody (M13), clone 2E5

SLC6A16 monoclonal antibody (M13), clone 2E5