SNX24 MaxPab mouse polyclonal antibody (B01)
  • SNX24 MaxPab mouse polyclonal antibody (B01)

SNX24 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00028966-B01
SNX24 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human SNX24 protein.
Información adicional
Size 50 uL
Gene Name SNX24
Gene Alias PRO1284|SBBI31
Gene Description sorting nexin 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNX24 (NP_054754, 1 a.a. ~ 169 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 28966

Enviar uma mensagem


SNX24 MaxPab mouse polyclonal antibody (B01)

SNX24 MaxPab mouse polyclonal antibody (B01)