SLC27A6 purified MaxPab mouse polyclonal antibody (B01P)
  • SLC27A6 purified MaxPab mouse polyclonal antibody (B01P)

SLC27A6 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00028965-B01P
SLC27A6 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC27A6 protein.
Información adicional
Size 50 ug
Gene Name SLC27A6
Gene Alias ACSVL2|DKFZp779M0564|FACVL2|FATP6|VLCS-H1
Gene Description solute carrier family 27 (fatty acid transporter), member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLLSWLTVLGAGMVVLHFVQKLLFTYFWDDFWFVLKVVLIIIRLKKYEKRGELVTVLDKFLSHAKRQPRKPFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVHVWFGLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENISVWGMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLIKSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC27A6 (AAH41945.1, 1 a.a. ~ 619 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28965

Enviar uma mensagem


SLC27A6 purified MaxPab mouse polyclonal antibody (B01P)

SLC27A6 purified MaxPab mouse polyclonal antibody (B01P)