OSTM1 monoclonal antibody (M05), clone 4H1
  • OSTM1 monoclonal antibody (M05), clone 4H1

OSTM1 monoclonal antibody (M05), clone 4H1

Ref: AB-H00028962-M05
OSTM1 monoclonal antibody (M05), clone 4H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant OSTM1.
Información adicional
Size 100 ug
Gene Name OSTM1
Gene Alias GIPN|GL|HSPC019|OPTB5
Gene Description osteopetrosis associated transmembrane protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SNSTVYFLNLFNHTLTCFEHNLQGNAHSLLQTKNYSEVCKNCREAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVPCSDT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OSTM1 (NP_054747.2, 183 a.a. ~ 282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28962
Clone Number 4H1
Iso type IgG2a Kappa

Enviar uma mensagem


OSTM1 monoclonal antibody (M05), clone 4H1

OSTM1 monoclonal antibody (M05), clone 4H1