MRPS28 purified MaxPab mouse polyclonal antibody (B01P)
  • MRPS28 purified MaxPab mouse polyclonal antibody (B01P)

MRPS28 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00028957-B01P
MRPS28 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MRPS28 protein.
Información adicional
Size 50 ug
Gene Name MRPS28
Gene Alias FLJ22853|HSPC007|MRP-S28|MRP-S35|MRPS35
Gene Description mitochondrial ribosomal protein S28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAALCRTRAVAAESHFLRVFLFFRPFRGVGTESGSESGSSNAKEPKTRAGGFASALERHSELLQKVEPLQKGSPKNVESFASMLRHSPLTQMGPAKDKLVIGRIFHIVENDLYIDFGGKFHCVCRRPEVDGEKYQKGTRVRLRLLDLELTSRFLGATTDTTVLEANAVLLGIQESKDSRSKEEHHEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MRPS28 (NP_054737.1, 1 a.a. ~ 187 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28957

Enviar uma mensagem


MRPS28 purified MaxPab mouse polyclonal antibody (B01P)

MRPS28 purified MaxPab mouse polyclonal antibody (B01P)