TRIB2 monoclonal antibody (M04), clone 1B1
  • TRIB2 monoclonal antibody (M04), clone 1B1

TRIB2 monoclonal antibody (M04), clone 1B1

Ref: AB-H00028951-M04
TRIB2 monoclonal antibody (M04), clone 1B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRIB2.
Información adicional
Size 100 ug
Gene Name TRIB2
Gene Alias C5FW|GS3955|TRB2
Gene Description tribbles homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28951
Clone Number 1B1
Iso type IgG2b Lambda

Enviar uma mensagem


TRIB2 monoclonal antibody (M04), clone 1B1

TRIB2 monoclonal antibody (M04), clone 1B1