TRIB2 purified MaxPab rabbit polyclonal antibody (D01P)
  • TRIB2 purified MaxPab rabbit polyclonal antibody (D01P)

TRIB2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00028951-D01P
TRIB2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TRIB2 protein.
Información adicional
Size 100 ug
Gene Name TRIB2
Gene Alias C5FW|GS3955|TRB2
Gene Description tribbles homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TRIB2 (NP_067675.1, 1 a.a. ~ 343 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28951

Enviar uma mensagem


TRIB2 purified MaxPab rabbit polyclonal antibody (D01P)

TRIB2 purified MaxPab rabbit polyclonal antibody (D01P)