DLL1 monoclonal antibody (M01), clone 4F8
  • DLL1 monoclonal antibody (M01), clone 4F8

DLL1 monoclonal antibody (M01), clone 4F8

Ref: AB-H00028514-M01
DLL1 monoclonal antibody (M01), clone 4F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DLL1.
Información adicional
Size 100 ug
Gene Name DLL1
Gene Alias DELTA1|DL1|Delta
Gene Description delta-like 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLL1 (NP_005609, 18 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28514
Clone Number 4F8
Iso type IgG2a Kappa

Enviar uma mensagem


DLL1 monoclonal antibody (M01), clone 4F8

DLL1 monoclonal antibody (M01), clone 4F8