DLL1 polyclonal antibody (A01)
  • DLL1 polyclonal antibody (A01)

DLL1 polyclonal antibody (A01)

Ref: AB-H00028514-A01
DLL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DLL1.
Información adicional
Size 50 uL
Gene Name DLL1
Gene Alias DELTA1|DL1|Delta
Gene Description delta-like 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DLL1 (NP_005609, 18 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 28514

Enviar uma mensagem


DLL1 polyclonal antibody (A01)

DLL1 polyclonal antibody (A01)