CDH19 purified MaxPab rabbit polyclonal antibody (D01P)
  • CDH19 purified MaxPab rabbit polyclonal antibody (D01P)

CDH19 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00028513-D01P
CDH19 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CDH19 protein.
Información adicional
Size 100 ug
Gene Name CDH19
Gene Alias CDH7|CDH7L2
Gene Description cadherin 19, type 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNCYLLLRFMLGIPLLWPCLGATENSQTKKVKQPVRSHLRVKRGWVWNQFFVPEEMNTTSHHIGQLRSDLDNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSDINDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISSKMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CDH19 (NP_066976.1, 1 a.a. ~ 772 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28513

Enviar uma mensagem


CDH19 purified MaxPab rabbit polyclonal antibody (D01P)

CDH19 purified MaxPab rabbit polyclonal antibody (D01P)