CDH19 polyclonal antibody (A01)
  • CDH19 polyclonal antibody (A01)

CDH19 polyclonal antibody (A01)

Ref: AB-H00028513-A01
CDH19 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDH19.
Información adicional
Size 50 uL
Gene Name CDH19
Gene Alias CDH7|CDH7L2
Gene Description cadherin 19, type 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMAYDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDH19 (NP_066976, 231 a.a. ~ 340 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 28513

Enviar uma mensagem


CDH19 polyclonal antibody (A01)

CDH19 polyclonal antibody (A01)