NKIRAS2 monoclonal antibody (M02), clone 2G9
  • NKIRAS2 monoclonal antibody (M02), clone 2G9

NKIRAS2 monoclonal antibody (M02), clone 2G9

Ref: AB-H00028511-M02
NKIRAS2 monoclonal antibody (M02), clone 2G9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant NKIRAS2.
Información adicional
Size 100 ug
Gene Name NKIRAS2
Gene Alias DKFZp434N1526|KBRAS2|MGC74742|kappaB-Ras2
Gene Description NFKB inhibitor interacting Ras-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NKIRAS2 (AAH07450, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28511
Clone Number 2G9
Iso type IgG1 Kappa

Enviar uma mensagem


NKIRAS2 monoclonal antibody (M02), clone 2G9

NKIRAS2 monoclonal antibody (M02), clone 2G9