PPP2R3B monoclonal antibody (M14), clone 1F4
  • PPP2R3B monoclonal antibody (M14), clone 1F4

PPP2R3B monoclonal antibody (M14), clone 1F4

Ref: AB-H00028227-M14
PPP2R3B monoclonal antibody (M14), clone 1F4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PPP2R3B.
Información adicional
Size 100 ug
Gene Name PPP2R3B
Gene Alias NY-REN-8|PPP2R3L|PPP2R3LY|PR48
Gene Description protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLESL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPP2R3B (AAH09032, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 28227
Clone Number 1F4
Iso type IgG1 Kappa

Enviar uma mensagem


PPP2R3B monoclonal antibody (M14), clone 1F4

PPP2R3B monoclonal antibody (M14), clone 1F4