PPP2R3B MaxPab mouse polyclonal antibody (B01)
  • PPP2R3B MaxPab mouse polyclonal antibody (B01)

PPP2R3B MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00028227-B01
PPP2R3B MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human PPP2R3B protein.
Información adicional
Size 50 uL
Gene Name PPP2R3B
Gene Alias NY-REN-8|PPP2R3L|PPP2R3LY|PR48
Gene Description protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PPP2R3B (AAH11180.1, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 28227

Enviar uma mensagem


PPP2R3B MaxPab mouse polyclonal antibody (B01)

PPP2R3B MaxPab mouse polyclonal antibody (B01)