MAT2B polyclonal antibody (A01)
  • MAT2B polyclonal antibody (A01)

MAT2B polyclonal antibody (A01)

Ref: AB-H00027430-A01
MAT2B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant MAT2B.
Información adicional
Size 50 uL
Gene Name MAT2B
Gene Alias MAT-II|MATIIbeta|MGC12237|Nbla02999|SDR23E1|TGR
Gene Description methionine adenosyltransferase II, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPEMPEDMEQEEVNIPNRRVLVTGATGLLGRAVHKEFQQNNWHAVGCGFRRARPKFEQVNLLDSNAVHHIIHDFQPHVIVHCAAERRPDVVENQPDAASQLNVDASGNLAKEAAAVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVMFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAT2B (AAH05218, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27430

Enviar uma mensagem


MAT2B polyclonal antibody (A01)

MAT2B polyclonal antibody (A01)