MCAT MaxPab rabbit polyclonal antibody (D01)
  • MCAT MaxPab rabbit polyclonal antibody (D01)

MCAT MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00027349-D01
MCAT MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MCAT protein.
Información adicional
Size 100 uL
Gene Name MCAT
Gene Alias FASN2C|MCT|MGC47838|MT|fabD
Gene Description malonyl CoA:ACP acyltransferase (mitochondrial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MCAT (NP_055322.1, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 27349

Enviar uma mensagem


MCAT MaxPab rabbit polyclonal antibody (D01)

MCAT MaxPab rabbit polyclonal antibody (D01)