MT MaxPab mouse polyclonal antibody (B01P)
  • MT MaxPab mouse polyclonal antibody (B01P)

MT MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027349-B01P
MT MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MT protein.
Información adicional
Size 50 ug
Gene Name MCAT
Gene Alias FASN2C|MCT|MGC47838|MT|fabD
Gene Description malonyl CoA:ACP acyltransferase (mitochondrial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGSTVSPEEFL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MT (NP_055322.1, 1 a.a. ~ 180 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27349

Enviar uma mensagem


MT MaxPab mouse polyclonal antibody (B01P)

MT MaxPab mouse polyclonal antibody (B01P)