RABGEF1 purified MaxPab mouse polyclonal antibody (B01P)
  • RABGEF1 purified MaxPab mouse polyclonal antibody (B01P)

RABGEF1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00027342-B01P
RABGEF1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RABGEF1 protein.
Información adicional
Size 50 ug
Gene Name RABGEF1
Gene Alias FLJ32302|RABEX5|rabex-5
Gene Description RAB guanine nucleotide exchange factor (GEF) 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGSKKEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RABGEF1 (NP_055319.1, 1 a.a. ~ 491 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27342

Enviar uma mensagem


RABGEF1 purified MaxPab mouse polyclonal antibody (B01P)

RABGEF1 purified MaxPab mouse polyclonal antibody (B01P)