PRPF19 polyclonal antibody (A01)
  • PRPF19 polyclonal antibody (A01)

PRPF19 polyclonal antibody (A01)

Ref: AB-H00027339-A01
PRPF19 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PRPF19.
Información adicional
Size 50 uL
Gene Name PRPF19
Gene Alias NMP200|PRP19|PSO4|SNEV|UBOX4|hPSO4
Gene Description PRP19/PSO4 pre-mRNA processing factor 19 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRPF19 (NP_055317, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27339

Enviar uma mensagem


PRPF19 polyclonal antibody (A01)

PRPF19 polyclonal antibody (A01)