UBE2S MaxPab rabbit polyclonal antibody (D01)
  • UBE2S MaxPab rabbit polyclonal antibody (D01)

UBE2S MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00027338-D01
UBE2S MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human UBE2S protein.
Información adicional
Size 100 uL
Gene Name UBE2S
Gene Alias E2-EPF|E2EPF|EPF5
Gene Description ubiquitin-conjugating enzyme E2S
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBE2S (NP_055316.2, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 27338

Enviar uma mensagem


UBE2S MaxPab rabbit polyclonal antibody (D01)

UBE2S MaxPab rabbit polyclonal antibody (D01)