RPS6KA6 monoclonal antibody (M06), clone 3G12
  • RPS6KA6 monoclonal antibody (M06), clone 3G12

RPS6KA6 monoclonal antibody (M06), clone 3G12

Ref: AB-H00027330-M06
RPS6KA6 monoclonal antibody (M06), clone 3G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RPS6KA6.
Información adicional
Size 50 ug
Gene Name RPS6KA6
Gene Alias RSK4
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS6KA6 (NP_055311.1, 636 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27330
Clone Number 3G12
Iso type IgG3 Kappa

Enviar uma mensagem


RPS6KA6 monoclonal antibody (M06), clone 3G12

RPS6KA6 monoclonal antibody (M06), clone 3G12