RPS6KA6 polyclonal antibody (A01)
  • RPS6KA6 polyclonal antibody (A01)

RPS6KA6 polyclonal antibody (A01)

Ref: AB-H00027330-A01
RPS6KA6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RPS6KA6.
Información adicional
Size 50 uL
Gene Name RPS6KA6
Gene Alias RSK4
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RPS6KA6 (NP_055311.1, 636 a.a. ~ 745 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27330

Enviar uma mensagem


RPS6KA6 polyclonal antibody (A01)

RPS6KA6 polyclonal antibody (A01)