ANGPTL3 monoclonal antibody (M10), clone 3F11
  • ANGPTL3 monoclonal antibody (M10), clone 3F11

ANGPTL3 monoclonal antibody (M10), clone 3F11

Ref: AB-H00027329-M10
ANGPTL3 monoclonal antibody (M10), clone 3F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ANGPTL3.
Información adicional
Size 100 ug
Gene Name ANGPTL3
Gene Alias ANGPT5
Gene Description angiopoietin-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq HLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANGPTL3 (NP_055310.1, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27329
Clone Number 3F11
Iso type IgG2a Kappa

Enviar uma mensagem


ANGPTL3 monoclonal antibody (M10), clone 3F11

ANGPTL3 monoclonal antibody (M10), clone 3F11