ANGPTL3 purified MaxPab rabbit polyclonal antibody (D01P)
  • ANGPTL3 purified MaxPab rabbit polyclonal antibody (D01P)

ANGPTL3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00027329-D01P
ANGPTL3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ANGPTL3 protein.
Información adicional
Size 100 ug
Gene Name ANGPTL3
Gene Alias ANGPT5
Gene Description angiopoietin-like 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ANGPTL3 (NP_055310.1, 1 a.a. ~ 460 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27329

Enviar uma mensagem


ANGPTL3 purified MaxPab rabbit polyclonal antibody (D01P)

ANGPTL3 purified MaxPab rabbit polyclonal antibody (D01P)