MOCS3 MaxPab rabbit polyclonal antibody (D01)
  • MOCS3 MaxPab rabbit polyclonal antibody (D01)

MOCS3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00027304-D01
MOCS3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MOCS3 protein.
Información adicional
Size 100 uL
Gene Name MOCS3
Gene Alias MGC9252|UBA4|dJ914P20.3
Gene Description molybdenum cofactor synthesis 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MOCS3 (NP_055299.1, 1 a.a. ~ 460 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 27304

Enviar uma mensagem


MOCS3 MaxPab rabbit polyclonal antibody (D01)

MOCS3 MaxPab rabbit polyclonal antibody (D01)